Invitrogen™ Human CTNNA3 (aa 151-223) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103793	100 μL

Catalog No. RP103793 Supplier Invitrogen™ Supplier No. RP103793

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63987. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catenins are proteins that connect cadherin/beta-catenin cell adhesion complexes to the actin cytoskeleton. Although originally discovered in testis, alphaT-catenin is expressed in other tissues, the highest levels being observed in heart. Immunohistochemical analysis showed human alphaTcatenin localization at intercalated discs of cardiomyocytes and in peritubular myoid cells of testis. It is proven that alphaT-catenin can functionally restore cell-cell adhesion in colon cancer cells lacking alpha-catenins. This indicates that this protein is involved in the formation of specific cell-cell contacts in specific types of muscle cells. The encoded protein has about the same predicted size (100 kDa) as other alpha-catenins to which it shows an overall amino acid identity of 57%. In cells transfected with alphaT-catenin cDNA, interaction with alpha-catenin was demonstrated by coimmunoprecipitation. The 892_24D2S antibody against alphaT-catenin does not show any cross reaction with alphaE-catenin or alphaNcatenin in western blot analysis.

Specifications

• Accession Number: Q9UI47
• Concentration: 2.1 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 29119
• Name: Human CTNNA3 (aa 151-223) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930429L08Rik; 4933408A16; Alpha T-catenin; Alpha-3 catenin; alpha-catenin-like protein; alpha-T-catenin; ARVD13; Cadherin-associated protein; catenin (cadherin associated protein), alpha 3; catenin (cadherin-associated protein), alpha 3; catenin alpha 3; catenin alpha-3; Catna3; CTNNA3; RGD1559455; RGD1562230; Vr22
• Common Name: CTNNA3
• Gene Symbol: CTNNA3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining