Invitrogen™ Human CTRL (aa 71-126) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95844	100 μL

Catalog No. RP95844 Supplier Invitrogen™ Supplier No. RP95844

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56958. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CTRL gene encodes chymotrypsin-like protein, a serine protease involved in the digestion of proteins by cleaving peptide bonds. It belongs to the chymotrypsin family of enzymes that are predominantly expressed in the pancreas and play crucial roles in the breakdown of dietary proteins in the small intestine. CTRL functions by hydrolyzing specific peptide bonds, contributing to efficient protein digestion and nutrient absorption. This enzyme's activity is tightly regulated to prevent premature activation within the pancreas, which could lead to pancreatitis or other digestive disorders. The study of the CTRL gene is significant in understanding the mechanisms of digestive health and in diagnosing pancreatic disorders. Furthermore, CTRL's enzyme activity and its role in proteolytic pathways make it an important target for research in digestive enzyme supplementation therapies and treatment strategies for conditions involving impaired protein digestion.

Specifications

• Accession Number: P40313
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1506
• Name: Human CTRL (aa 71-126) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0910001G08Rik; 1810004D15Rik; AV005227; chymopasin; chymotrypsin A CTRA-1; chymotrypsin like; chymotrypsin-like; chymotrypsin-like protease CTRL-1; Ctra1; Ctra-1; CTRL; CTRL1; mFLJ00366
• Common Name: CTRL
• Gene Symbol: Ctrl
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining