Invitrogen™ Human Cyclophilin 40 (aa 293-364) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92534	100 μL

Catalog No. RP92534 Supplier Invitrogen™ Supplier No. RP92534

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localized to the nucleus, and is coupled to the cell cycle. The testicular form is expressed in embryonic tissues, tumor cells, and the testis. In male germ cells, this protein is localized to the cytoplasm of primary spermatocytes, the nucleus of spermatids, and the periacrosomal region of mature spermatozoa.

Specifications

• Accession Number: Q08752
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5481
• Name: Human Cyclophilin 40 (aa 293-364) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 40 kDa peptidyl-prolyl cis-trans isomerase; 40 kDa peptidyl-prolyl cis-trans isomerase D; 4930564J03Rik; cyclophilin 40; cyclophilin D; cyclophilin-40; Cyclophilin-related protein; Cyp 40; Cyp D; CYP40; CYP-40; CYPD; CYP-S1; cytoplasmic cyclophilin D; EC 5.2.1.8; I79_011990; MGC33096; peptidyl-prolyl cis-trans isomerase D; peptidylprolyl isomerase D; peptidylprolyl isomerase D (cyclophilin D); PPIase; PPIase D; PPID; Ppidl; Ppif; rotamase; Rotamase D; S-cyclophilin; SCYLP; testicular tissue protein Li 147
• Common Name: Cyclophilin 40
• Gene Symbol: PPID
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining