Invitrogen™ Human CYP11B1 (aa 156-242) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104168	100 μL

Catalog No. RP104168 Supplier Invitrogen™ Supplier No. RP104168

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63290. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The steroid 11beta-hydroxylase gene, also designated Cyp11b-1, is a marker for the functional differentiation of cells in the zonae fasciculata reticularis. The deduced protein CYP11B1 consists of 466 amino acids containing a secretory signal, epidermal growth factor-like repeats, and a proteolytically inactive cathepsin B-related sequence. A related protein, human aldosterone synthase (CYP11B2), is involved in substrate recognition and conversion, with a functionally significant residue 112 in the N-terminal region of human CYP11B2. The inherited disorder glucocorticoid-remediable aldosteronism is caused by a chimeric gene duplication between the CYP11B1 and CYP11B2 genes. This disorder is characterized by hyperaldosteronism and high levels of 18-hydroxycortisol and 18-oxocortisol, which are under ACTH control.

Specifications

• Accession Number: P15538
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1584
• Name: Human CYP11B1 (aa 156-242) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 11-beta-hydroxylase; AA389061; aldosterone synthase; Cp11ba; CPN1; CYP11B; CYP11B1; Cyp11b-1; CYPXIB1; Cytochrome P450 11B1, mitochondrial; cytochrome P450 family 11 subfamily B member 1; cytochrome p450 XIB1; cytochrome P450(11 beta)-DS; cytochrome P450, family 11, subfamily b, polypeptide 1; cytochrome P450, subfamily 11B, polypeptide 1; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1; Cytochrome P450, subfamily XIB, polypeptide 1 (steroid 11-beta-hydroxylase); cytochrome P450C11; cytochrome P-450c11; DKFZp686B05283; FHI; FLJ36771; P450(11 beta)-DS; P450C 11; P450C11; RATCP11BA; S11BH; steroid 11-beta-hydroxylase; steroid 11-beta-hydroxylase, CYP11B1; steroid 11-beta-monooxygenase; steroid-11-beta-hydroxylase
• Common Name: CYP11B1
• Gene Symbol: CYP11B1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining