Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human CYP11B2 (aa 406-451) Control Fragment Recombinant Protein

Catalog No. RP99283
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99283 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99283 Supplier Invitrogen™ Supplier No. RP99283
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61902. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19099
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 1585
Name Human CYP11B2 (aa 406-451) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias ALDOS; Aldosterone synthase; aldosterone-synthesizing enzyme; Corticosterone 18-monooxygenase, CYP11B2; Cp45as; Cpn2; Cyp11b; CYP11B2; Cyp11b-2; Cyp11b3; CYP11BL; CYPXIB2; CYPXIB3; cytochrome P450 11B2, mitochondrial; cytochrome P450 11B3, mitochondrial; cytochrome P450 family 11 subfamily B member 2; Cytochrome P450 subfamily XIB polypeptide 2 (aldosterone synthase); cytochrome P450, family 11, subfamily b, polypeptide 2; cytochrome P450, subfamily 11B, polypeptide 2; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2; Cytochrome P450, subfamily XIB, polypeptide 2 (aldosterone synthase); cytochrome P-450Aldo; cytochrome P450-Aldo-1; cytochrome P450-Aldo-2; cytochrome P450C11; Cytochrome P-450C18; mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2; P450aldo; P450-Aldo-1; P450-Aldo-2; P450C 18; P-450C 18; P450C18; P-450C18; RNCP45AS; steroid 11-beta/18-hydroxylase; steroid 11-beta-hydroxylase; Steroid 11-beta-hydroxylase, CYP11B2; steroid 11-beta-monooxygenase; Steroid 18-hydroxylase; steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo; steroid-11-beta-hydroxylase
Common Name CYP11B2
Gene Symbol CYP11B2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.