Invitrogen™ Human Cytohesin 3 (aa 2-72) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90693	100 μL

Catalog No. RP90693 Supplier Invitrogen™ Supplier No. RP90693

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82492. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRP1 (general receptor for phosphoinositides-1) contains a Pleckstrin homology (PH) domain as well as a Sec7 domain. The PH domain has high binding affinity for phosphatidylinositol 3,4,5-trisphosphate Ptdlns(3,4,5)P3), while the Sec7 homology domain is responsible for catalyzing guanine nucleotide exchange of ADP-ribosylation factor (ARF) proteins. GRP1 co-localizes with ARF6 and catalyzes GTP/GDP exchange on ARF6. It is known to interact with Ptdlns(3,4,5)P3 localized to the plasma membrane in vitro and may also be a Ptdlns(3,4,5)P3 receptor. Additionally, GRP1 may regulate protein sorting and membrane trafficking through interaction with the guanosine triphosphate ARF, and may control cell adhesion through interaction with integrins.

Specifications

• Accession Number: O43739
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9265
• Name: Human Cytohesin 3 (aa 2-72) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI648983; ARF nucleotide-binding site opener 3; ARNO3; CLM3; CYTH3; cytohesin 3; cytohesin-3; General receptor of phosphoinositides 1; GRP1; mSec7-3; PH, SEC7 and coiled-coil domain-containing protein 3; pleckstrin homology, Sec7 and coiled/coil domains 3; pleckstrin homology, Sec7 and coiled-coil domains 3; Protein ARNO3; PSCD3; rSec7-3; Sec7; SEC7 homolog C; Sec7C
• Common Name: Cytohesin 3
• Gene Symbol: Cyth3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining