Invitrogen™ Human DAAM2 (aa 4-59) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101346	100 μL

Catalog No. RP101346 Supplier Invitrogen™ Supplier No. RP101346

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62993. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DAAM2 is a recently identified planar cell polarity (PCP) signaling molecule implicated in the regulation of cellular polarity, convergent extension, and invasion. DAAM2 belongs to the formin homology family and contains a DAD (diaphanous autoregulatory) domain, an FH1 (formin homology 1) domain, an FH2 (formin homology 2) domain and a GBD/FH3 (Rho GTPase-binding/ formin homology 3) domain. The DAAM2 protein is known to be involved in cell divison. Though the exact function of DAAM2 is yet unknown, reports suggest that it is closely related to DAAM1 and hence along with DAAM1 it may also be required in Wnt/Fz signaling and activation of Rho and in regulating cytoskeleton architecture. DAAM2 is expressed in most of tissues but the expression level ishigher in brain.

Specifications

• Accession Number: Q86T65
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23500
• Name: Human DAAM2 (aa 4-59) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310016D11Rik; AI843643; AW557870; Daam2; Disheveled-associated activator of morphogenesis 2; dishevelled associated activator of morphogenesis 2; dishevelled-associated activator of morphogenesis 2; dJ90A20A.1; Kiaa0381; RP1-278E11.1
• Common Name: DAAM2
• Gene Symbol: DAAM2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining