Invitrogen™ Human DCP1A Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108146	100 μL

Catalog No. RP108146 Supplier Invitrogen™ Supplier No. RP108146

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82478. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Signal transduction of TGF-beta superfamily members is regulated by Smad proteins. In particular, Smads influence specific gene transcription by relaying signals from the cell membrane to the nucleus. Smad4 plays an essential role in TGF-beta-induced transcriptional activation wherein phosphorylated receptor-associated Smads associate with Smad4. Furthermore, SMIF (Smad4-intereacting protein) and Smad4 complex with TGF-beta and BMP4. An increase in Smad4 concentration increases the translocation of this complex to the nucleus. SMIF and Smad4 interact directly through a EVH1/WH1 domain on SMIF and a proline-rich activation domain on Smad4. Smad4 is essential to nuclear translocation of SMIF as deletion of the Smad4-interacting domain (located in the N-terminal 100 amino acids) of SMIF eliminates TGF-beta-induced nuclear translocation of SMIF. The human SMIF gene is ubiquitously expressed and encodes a protein with a relative molecular mass of 70 kDa.

Specifications

• Accession Number: Q9NPI6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55802
• Name: Human DCP1A Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110066A22Rik; 4930568L04Rik; AU019772; D14Ertd817e; DCP1 decapping enzyme homolog A; DCP1 decapping enzyme homolog A (S. cerevisiae); DCP1 decapping enzyme-like protein A; DCP1A; decapping enzyme; decapping enzyme hDcp1a; decapping mRNA 1A; FLJ21691; HSA275986; MAD homolog 4 interacting transcription coactivator 1; MAD homolog 4-interacting transcription coactivator 1; Mitc1; mRNA-decapping enzyme 1A; Nbla00360; putative protein product of Nbla00360; RGD1561298; Smad4-interacting transcriptional co-activator; SMAD4IP1; SMIF; test2; transcription factor SMIF
• Common Name: DCP1A
• Gene Symbol: Dcp1a
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSASA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining