Invitrogen™ Human DDHD2 (aa 119-194) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93745	100 μL

Catalog No. RP93745 Supplier Invitrogen™ Supplier No. RP93745

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54705. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DDHD2, also known as KIAA0725p, is a member of the intracellular phospholipase A1 (PLA1) protein family which comprises a group of enzymes that hydrolyze the sn-1 ester bond of phospholipids, producing 2-acyl-lysophospholipids and fatty acids. DDHD2 prefers phosphatidic acid as substrate and has a role in efficient membrane trafficking from the Golgi apparatus to the plasma membrane. The gene of DDHD2 maps to chromosome 8p11.23, and encodes a 711-amino-acid protein with a calculated molecular mass of 81 kDa. It has been reported that DDHD2 immunoblot analysis of various tissue extracts revealed two bands of 90 and 85 kDa.

Specifications

• Accession Number: O94830
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23259
• Name: Human DDHD2 (aa 119-194) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2010305K11Rik; DDHD domain containing 2; DDHD domain-containing protein 2; Ddhd2; intracellular phospholipase A1gamma; iPLA(1)gamma; KIAA0725; KIAA0725p; mKIAA0725; PA-PLA1 like; phospholipase DDHD2; SAM, WWE and DDHD domain-containing protein 1; Samwd1; sec23p-interacting protein p125-like phosphatidic acid-preferring phospholipase A1; SPG54
• Common Name: DDHD2
• Gene Symbol: DDHD2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDKDNKYVPYSESFSQVLEETYMLAVTLDEWKKKLESPNREIIILHNPKLMVHYQPVAGSDDWGSTPTEQGRPRTV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining