Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human DDX1 (aa 459-548) Control Fragment Recombinant Protein

Catalog No. RP95988
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95988 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95988 Supplier Invitrogen™ Supplier No. RP95988
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83227. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DDX1 (ATP-dependent RNA helicase DDX1) acts as an ATP-dependent RNA helicase. It is able to unwind both RNA-RNA and RNA-DNA duplexes. DDX1 possesses 5' single-stranded RNA overhand nuclease activity and ATPase activity on various RNA, but not DNA polynucleotides. DDX1, together with RELA, acts as a coactivator to enhance NF-kappa-b-mediated transcriptional activation. It also acts as a positive transcriptional regulator of cyclin CCND2 expression. It binds to the cyclin CCND2 promoter region. DDX1 is a component of a multi-helicase-TICAM1 complex that acts as a cytoplasmic sensor of viral double stranded RNA and plays a role in activation of a cascade of antiviral responses including the induction of proinflammatory cytokines via the adapter molecule TICAM1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92499
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 1653
Name Human DDX1 (aa 459-548) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AA409185; ATP-dependent RNA helicase DDX1; DBP-RB; Ddx1; DEAD (Asp-Glu-Ala-Asp) box helicase 1; DEAD (Asp-Glu-Ala-Asp) box polypeptide 1; DEAD box polypeptide 1; DEAD box protein 1; DEAD box protein retinoblastoma; DEAD box-1; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1; DEAD/H-box helicase 1; UKVH5d
Common Name DDX1
Gene Symbol DDX1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.