Invitrogen™ Human DDX3 (aa 21-168) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92136	100 μL

Catalog No. RP92136 Supplier Invitrogen™ Supplier No. RP92136

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the large DEAD-box protein family, that is defined by the presence of the conserved Asp-Glu-Ala-Asp (DEAD) motif, and has ATP-dependent RNA helicase activity. This protein has been reported to display a high level of RNA-independent ATPase activity, and unlike most DEAD-box helicases, the ATPase activity is thought to be stimulated by both RNA and DNA. This protein has multiple conserved domains and is thought to play roles in both the nucleus and cytoplasm. Nuclear roles include transcriptional regulation, mRNP assembly, pre-mRNA splicing, and mRNA export. In the cytoplasm, this protein is thought to be involved in translation, cellular signaling, and viral replication. Misregulation of this gene has been implicated in tumorigenesis. This gene has a paralog located in the nonrecombining region of the Y chromosome. Pseudogenes sharing similarity to both this gene and the DDX3Y paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: O00571
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1654
• Name: Human DDX3 (aa 21-168) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ATP-dependent RNA helicase DDX3X; CAP-Rf; D1Pas1-related sequence 2; D1Pas1-rs2; DBX; DDX14; DDX3; Ddx3x; D-E-A-D (aspartate-glutamate-alanine-aspartate) box polypeptide 3; DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 3; DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked; DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked; DEAD box protein 3, X-chromosomal; DEAD box RNA helicase DEAD3; DEAD box, X isoform; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked; DEAD/H box-3; Dead3; DEAD-box helicase 3, X-linked; DEAD-box protein 3 (DEAD-box RNA helicase DEAD3) (mDEAD3) (Embryonic RNA helicase) (D1PAS1 related sequence 2); Embryonic RNA helicase; Erh; fibroblast growth factor inducible 14; Fin14; Helicase-like protein 2; HLP2; mDEAD3; MRX102
• Common Name: DDX3
• Gene Symbol: DDX3X
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining