Invitrogen™ Human DDX5 (aa 48-186) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100943	100 μL

Catalog No. RP100943 Supplier Invitrogen™ Supplier No. RP100943

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82711. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. This gene consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.

Specifications

• Accession Number: P17844
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1655
• Name: Human DDX5 (aa 48-186) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2600009A06Rik; ATP-dependent RNA helicase DDX5; DDX5; ddx5 gene protein; D-E-A-D (aspartate-glutamate-alanine-aspartate) box polypeptide 5; DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 5; DEAD (Asp-Glu-Ala-Asp) box helicase 5; DEAD (Asp-Glu-Ala-Asp) box polypeptide 5; DEAD box protein 5; DEAD box RNA helicase DEAD1; DEAD box-5; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD); DEAD-box helicase 5; DKFZp434E109; DKFZp686J01190; G17P1; HELR; Hlr1; HUMP68; mDEAD1; MGC118083; p68; p68 RNA helicase; PCR product with interspecies-compatible primers; probable ATP-dependent RNA helicase DDX5; RNA helicase p68; RP23-247J12.4
• Common Name: DDX5
• Gene Symbol: DDX5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining