Invitrogen™ Human DDX56 (aa 75-159) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92732	100 μL

Catalog No. RP92732 Supplier Invitrogen™ Supplier No. RP92732

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54072. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene shows ATPase activity in the presence of polynucleotides and associates with nucleoplasmic 65S preribosomal particles. This gene may be involved in ribosome synthesis, most likely during assembly of the large 60S ribosomal subunit.

Specifications

• Accession Number: Q9NY93
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54606
• Name: Human DDX56 (aa 75-159) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2600001H07Rik; 61-kd nucleolar helicase; ATP-dependent 61 kDa nucleolar RNA helicase; D11Ertd619e; DDX21; DDX26; DDX56; DEAD (Asp-Glu-Ala-Asp) box helicase 56; DEAD (Asp-Glu-Ala-Asp) box polypeptide 56; DEAD box protein 21; DEAD box protein 56; DEAD-box helicase 56; DEAD-box RNA helicase; NOH61; nucleolar helicase of 61 kDa; nucleolar RNA helicase homolog; probable ATP-dependent RNA helicase DDX56; putative nucleolar RNA helicase; RH-II/Gu; RNA helicase II/Gu
• Common Name: DDX56
• Gene Symbol: DDX56
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining