Invitrogen™ Human Dectin 1 (aa 159-246) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104894	100 μL

Catalog No. RP104894 Supplier Invitrogen™ Supplier No. RP104894

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLEC7A, also known as dectin-1, is a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily and is predominantly expressed on myeloid cells. It is a small glycoprotein type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif (ITAM). CLEC7A functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Upon fungal exposure, CLEC7A activates Syk tyrosine kinase, triggering a massive oxidative burst through the formation of reactive oxygen species.

Specifications

• Accession Number: Q9BXN2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64581
• Name: Human Dectin 1 (aa 159-246) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Beta-glucan receptor; beta-GR; BGR; CANDF4; CD369; CLEC7A; Clec7b; CLECSF12; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 12; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; C-type lectin domain family 7 member A; C-type lectin domain family 7, member A; C-type lectin superfamily member 12; DC-associated C-type lectin 1; DECTIN1; dectin-1; Dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; lectin-like receptor 1; RGD1565140; SCARE2; UNQ539/PRO1082
• Common Name: Dectin 1 (Clec7a)
• Gene Symbol: Clec7a
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining