Invitrogen™ Human DEFB132 (aa 32-95) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99472	100 μL

Catalog No. RP99472 Supplier Invitrogen™ Supplier No. RP99472

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61233. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Beta-defensins (also designated BDs, or hBDs in human) are small cationic peptides with broad-spectrum antimicrobial activity against a variety of enveloped viruses, fungi and bacteria. Produced in mucosal epithelia and neutrophils of several species, beta-defensins are developmentally regulated. The family of beta-defensin proteins share a common defensin-motif that is characterized by multiple cysteine residues and a highly conserved tertiary structure. Besides playing a significant role in host immune defense, many beta-defensins also are involved in sperm maturation and capacitation. beta-defensin 32, also known as beta-defensin 132, is a 95 amino acid secreted protein that most likely contains a signal peptide sequence that requires cleavage by proteolytic enzymes in order to become biologically active.

Specifications

• Accession Number: Q7Z7B7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 400830
• Name: Human DEFB132 (aa 32-95) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BD-32; Beta-defensin 132; beta-defensin 32; DEFB132; DEFB32; DEFB-32; defensin beta 132; defensin HEL-75; Defensin, beta 132; defensin, beta 32; HEL-75; KFLL827; RP5-1103G7.6; UNQ827; UNQ827/PRO1754
• Common Name: DEFB132
• Gene Symbol: DEFB132
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining