Invitrogen™ Human DGKQ (aa 498-598) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102422	100 μL

Catalog No. RP102422 Supplier Invitrogen™ Supplier No. RP102422

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55422. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Diacylglycerol (DAG) is a fundamental lipid second messenger that is produced in the nucleus. The accumulation of DAG in the nucleus is important for the regulation of cell growth and differentiation. Diacylglycerol kinases (DGKs) convert DAG to phosphatidic acid, thereby terminating diacylglycerol signaling, which results in the reduction of protein kinase C activity and cell cycle progression of T lymphocytes. Diacylglycerol kinases are divided into five subtypes, Type I-Type V. DGK-theta is a Type V DGK, and localizes mainly to the nucleus of various cell lines, such as MDA-MB-453, MCF-7, PC12 and HeLa. Nuclear DGK-theta co-localizes with phosphatidylinositol 4, 5-bisphosphate (PIP(2)). DGK-theta is the isoform responsive to alpha-Thrombin stimulation.

Specifications

• Accession Number: P52824
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1609
• Name: Human DGKQ (aa 498-598) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 110kDa; DAG kinase theta; DAGK; Dagk4; DAGK7; Dgk theta; Dgkd; DGKQ; DGK-theta; Diacylglycerol kinase theta; diacylglycerol kinase, delta (110 kDa); diacylglycerol kinase, theta; diacylglycerol kinase, theta 110kDa; diglyceride kinase theta; testis tissue sperm-binding protein Li 38a
• Common Name: DGKQ
• Gene Symbol: DGKQ
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining