Invitrogen™ Human DHX32 (aa 271-363) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97018	100 μL

Catalog No. RP97018 Supplier Invitrogen™ Supplier No. RP97018

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61825. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.

Specifications

• Accession Number: Q7L7V1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55760
• Name: Human DHX32 (aa 271-363) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3110079L04Rik; 4732469F02Rik; AA408140; Ddx32; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 32; DEAD/H box 32; DEAD/H helicase-like protein 1; DEAD/H helicase-like protein-1; DEAH (Asp-Glu-Ala-His) box polypeptide 32; DEAH box protein 32; DEAH-box helicase 32 (putative); DHLP1; DHX32; helicase DDX32; huDDX32; MuDDX32; putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
• Common Name: DHX32
• Gene Symbol: DHX32
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKGDIVVFLACEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining