Invitrogen™ Human DHX36 (aa 89-179) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96443	100 μL

Catalog No. RP96443 Supplier Invitrogen™ Supplier No. RP96443

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57259. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp, are putative RNA helicases implicated in several cellular processes involving modifications of RNA secondary structure. DHX36 (DEAH box protein 36), also known as MLE-like protein 1 and RNA helicase associated with AU-rich element ARE (RHAU), belongs to RNA helicase of the DEAH family and may function in sex development and spermatogenesis. It is expressed in testis and is evolutionary conserved with true orthologs in almost all animal species. DHX36 plays a role in degradation and deadenylation of mRNAs containing in their 3'-UTR the consensus ARE sequence element. DHX36 is required for early embryogenesis.

Specifications

• Accession Number: Q9H2U1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 170506
• Name: Human DHX36 (aa 89-179) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810407E23Rik; AI452301; Asp-Glu-Ala-His; ATP-dependent DNA/RNA helicase DHX36; ATP-dependent RNA helicase DHX36; AU022184; Ddx36; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36; DEAD/H box polypeptide 36; DEAH (Asp-Glu-Ala-His) box polypeptide 36; DEAH box protein 36; DEAH-box helicase 36; DEAH-box protein 36; DHX36; G4 resolvase-1; G4R1; G4-resolvase 1; G4-resolvase-1; KIAA1488; mKIAA1488; Mlel1; MLE-like protein 1; probable ATP-dependent RNA helicase DHX36; RHAU; RNA helicase associated with AU-rich element ARE; RNA helicase associated with AU-rich element protein
• Common Name: DHX36
• Gene Symbol: DHX36
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining