Invitrogen™ Human DIO2 (aa 50-123) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106163	100 μL

Catalog No. RP106163 Supplier Invitrogen™ Supplier No. RP106163

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65489. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the iodothyronine deiodinase family. It activates thyroid hormone by converting the prohormone thyroxine by outer ring deiodination to bioactive 3,3',5-triiodothyronine residues encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q92813
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1734
• Name: Human DIO2 (aa 50-123) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5DII; AI324267; D2; deiodinase, iodothyronine, type 2; deiodinase, iodothyronine, type II; deiodinase-2; deiodonase-2; Dio2; DIOII; iodothyronine type II deiodinase; Itdi2; SelY; thyroxine deiodinase; thyroxine deiodinase, type II; thyroxine type II; TXDI2; Type 2 DI; type 2 iodothyronine deiodinase; type II iodothyronine deiodinase; type-II 5' deiodinase; type-II 5'deiodinase; type-II 5'-deiodinase
• Common Name: DIO2
• Gene Symbol: DIO2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining