Invitrogen™ Human DLG5 (aa 867-973) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105684	100 μL

Catalog No. RP105684 Supplier Invitrogen™ Supplier No. RP105684

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role at the plasma membrane in the maintenance of the structure of epithelial cells and in the transmission of extracellular signals to the membrane and cytoskeleton.

Specifications

• Accession Number: Q8TDM6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9231
• Name: Human DLG5 (aa 867-973) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4933429D20Rik; discs large homolog 5; discs large MAGUK scaffold protein 5; discs large protein LP-DLG; discs large protein P-dlg; discs, large homolog 5; discs, large homolog 5 (Drosophila); disks large homolog 5; DLG5; KIAA0583; large type of P-DLG; LP-DLG; mKIAA0583; PDLG; P-DLG5; Placenta and prostate DLG; T25557
• Common Name: DLG5
• Gene Symbol: Dlg5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining