Invitrogen™ Human DLK1 (aa 239-303) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101578	100 μL

Catalog No. RP101578 Supplier Invitrogen™ Supplier No. RP101578

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Delta-like 1 homolog (DLK1) is a transmembrane protein containing six epidermal growth factor repeats. It is involved in the differentiation of several cell types, including adipocytes and is also thought to be a tumor suppressor. The DLK1 gene is one of several imprinted genes located in a region on chromosome 14q32; certain mutations in this imprinted region can cause phenotypes similar to maternal and paternal uniparental disomy of chromosome 14 (UPD14). DLK1 is expressed from the paternal allele; a polymorphism within this gene has been associated with child and adolescent obesity.

Specifications

• Accession Number: P80370
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8788
• Name: Human DLK1 (aa 239-303) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Adipocyte differentiation inhibitor protein; AW742678; delta like non-canonical Notch ligand 1; Delta1; delta-like 1 homolog; delta-like 1 homolog (Drosophila); DLK; Dlk1; DLK-1; DlkI; FA1; Fetal antigen 1; Ly107; Peg9; pG2; Preadipocyte factor 1; preadipocyte factor-1; PREF; Pref1; pref-1; Protein delta homolog 1; SCP1; Scp-1; secredeltin; stromal cell derived protein 1; ZOG
• Common Name: DLK1
• Gene Symbol: DLK1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining