Invitrogen™ Human DMKN Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109715	100 μL

Catalog No. RP109715 Supplier Invitrogen™ Supplier No. RP109715

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein is still unknown. The human ZD52F10 gene is up-regulated in colon cancer metastasis. It encode the protein (dermokine), which is a new stratified epithelium-secreted protein.

Specifications

• Accession Number: Q6E0U4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 93099
• Name: Human DMKN Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110014F24Rik; AW561900; C130074A08; cI-36; Dermokine; Dmkn; Epidermis-specific secreted protein SK30/SK89; RGD1561521; SK30; SK89; UNQ729; UNQ729/PRO1411; ZD52F10
• Common Name: DMKN
• Gene Symbol: Dmkn
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STGTNIGEALGHGLGDALSEGVGKAIGKEAGGAAGSKVSEALGQGTREAVGTGVRQVPGFGAADALGNRVGEAAHALGNTGHEIGRQAEDVIRHGADAVRGSWQGVPGHNGAWETSGGHGIFGSQG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining