Invitrogen™ Human DNAH14 (aa 3107-3202) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102594	100 μL

Catalog No. RP102594 Supplier Invitrogen™ Supplier No. RP102594

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56720. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly.

Specifications

• Accession Number: Q0VDD8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 127602
• Name: Human DNAH14 (aa 3107-3202) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Axonemal beta dynein heavy chain 14; C1orf67; Ciliary dynein heavy chain 14; DNAH14; Dnahc14; dynein axonemal heavy chain 14; dynein heavy chain 14, axonemal; dynein, axonemal, heavy chain 14; dynein, axonemal, heavy polypeptide 14; HL18; HL-18
• Common Name: DNAH14
• Gene Symbol: DNAH14
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALNNYHEVQKVVGPKQIQVAEAQNVLKIARQRLAEKQRGLQLVEEHLLFLQAAYKDTVAEKQLLANRKTMASRRFQCASVLLTVLEDEKTRWQETI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining