Invitrogen™ Human DOCK4 (aa 1723-1788) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107821	100 μL

Catalog No. RP107821 Supplier Invitrogen™ Supplier No. RP107821

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67177. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DOCK4 gene encodes the dedicator of cytokinesis 4 protein, a member of the DOCK family, which functions as a guanine nucleotide exchange factor (GEF) for small Rho GTPases, specifically Rac1 and Rap1. DOCK4 is critical for regulating various cellular processes, including cell migration, polarity, and cytoskeletal organization. It plays a significant role in maintaining the integrity of endothelial barriers and mediating intercellular junctions. Mutations or altered expression of DOCK4 have been implicated in cancer progression, particularly in tumor metastasis and invasion, by affecting the adhesion and migration of cancer cells. Additionally, DOCK4 is involved in neurodevelopmental processes and has been associated with psychiatric disorders, reflecting its importance in brain function and development. Understanding the roles of DOCK4 in both health and disease could provide insights into therapeutic strategies for cancer and neurological disorders where these pathways are disrupted.

Specifications

• Accession Number: Q8N1I0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9732
• Name: Human DOCK4 (aa 1723-1788) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5330406C03; 6330411N01Rik; AF263288; C030023J22; dedicator of cytokinesis 4; dedicator of cytokinesis protein 4; DOCK4; Kiaa0716; mKIAA0716; RGD1561724
• Common Name: DOCK4
• Gene Symbol: DOCK4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CSAIYPTPVEPSQRMLFNHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining