Invitrogen™ Human DOHH Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109546	100 μL

Catalog No. RP109546 Supplier Invitrogen™ Supplier No. RP109546

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140187 (PA5-140187. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9BU89
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83475
• Name: Human DOHH Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Deoxyhypusine dioxygenase; deoxyhypusine hydroxylase; deoxyhypusine hydroxylase/monooxygenase; deoxyhypusine monooxygenase; DOHH; hDOHH; HEAT-like (PBS lyase) repeat containing 1; HEAT-like repeat-containing protein 1; HLRC1
• Common Name: DOHH
• Gene Symbol: DOHH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TENPMVRHECAEALGAIAQPACLAALQAHADDPERVVRESCEVALDMYEHETG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining