Invitrogen™ Human DPP6 (aa 582-662) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101264	100 μL

Catalog No. RP101264 Supplier Invitrogen™ Supplier No. RP101264

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62201. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DPP6 encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Specifications

• Accession Number: P42658
• Concentration: 2.10 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1804
• Name: Human DPP6 (aa 582-662) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B930011P16Rik; D5Buc3; D5Buc4; D5Buc5; dipeptidyl aminopeptidase IV-related protein; dipeptidyl aminopeptidase-like protein 6; Dipeptidyl aminopeptidase-related protein; Dipeptidyl peptidase 6; Dipeptidyl peptidase IV-like protein; dipeptidyl peptidase IV-related protein; dipeptidyl peptidase like 6; dipeptidyl peptidase VI; dipeptidylpeptidase 6; dipeptidyl-peptidase 6; dipeptidylpeptidase VI; DPL1; DPP VI; Dpp6; Dpp-6; DPPX; Gm1377; In(5)6H p; In(5)6H-p; inversion, Chr 5, Harwell 6, proximal; MRD33; Peplb; Rw; VF2
• Common Name: DPP6
• Gene Symbol: DPP6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining