Invitrogen™ Human DPPA2 (aa 102-183) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96402	100 μL

Catalog No. RP96402 Supplier Invitrogen™ Supplier No. RP96402

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DPPA2 (Developmental Pluripotency Associated 2) gene is prominently expressed in embryonic stem cells and is critical for maintaining their pluripotency and self-renewal capabilities. Located on chromosome 3, DPPA2 belongs to a family of genes that play significant roles in early embryonic development and epigenetic remodeling. The expression of DPPA2 is tightly regulated through mechanisms such as DNA methylation, and it is involved in regulatory pathways that control the expression of core pluripotency factors. Beyond its role in stem cell biology, DPPA2 expression is also noted in various cancers, where it can become reactivated, suggesting its involvement in oncogenic processes. In the context of cancer, DPPA2, along with DPPA4, has been studied for its potential to facilitate cellular reprogramming and contribute to tumorigenesis. Given its expression pattern, DPPA2 serves as both a marker of pluripotent potential in stem cells and a potential target for cancer diagnostics and therapy due to its reactivation in malignant tissues.

Specifications

• Accession Number: Q7Z7J5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 151871
• Name: Human DPPA2 (aa 102-183) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410088E07Rik; C80932; cancer/testis antigen 100; CT100; D19Mgi18; developmental pluripotency associated 2; developmental pluripotency-associated 2; developmental pluripotency-associated protein 2; DPPA2; ECAT15-2; ECSA; embryonic stem cell (ESC) associated transcript 15-2; embryonic stem cell-associated transcript 15-2 protein; LOC683282; PESCRG1; Phsecrg1; Pluripotent embryonic stem cell-related gene 1 protein; similar to developmental pluripotency-associated 2
• Common Name: DPPA2
• Gene Symbol: DPPA2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining