Invitrogen™ Human DPPA4 (aa 6-97) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96328	100 μL

Catalog No. RP96328 Supplier Invitrogen™ Supplier No. RP96328

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83266. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DPPA4 gene encodes developmental pluripotency associated 4, a protein that plays a crucial role in maintaining stem cell pluripotency and facilitating early embryonic development. DPPA4 is primarily expressed in pluripotent stem cells, such as embryonic stem cells, where it contributes to the regulation of gene expression and chromatin structure necessary for pluripotency and differentiation. This protein is also involved in the establishment of epigenetic marks that influence developmental pathways, ensuring the proper formation of tissue types during embryogenesis. DPPA4 functions in stem cell renewal and differentiation, impacting cellular processes that are fundamental to early development. Beyond its roles in normal physiology, DPPA4 has been studied in the context of oncology, where its expression is often upregulated in certain cancers, indicating its potential as a biomarker for tumorigenic stem cell-like properties. Research continues to explore DPPA4's mechanisms and interactions to understand its contributions to development and its implications in disease states, particularly in cancer biology and regenerative medicine.

Specifications

• Accession Number: Q7L190
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55211
• Name: Human DPPA4 (aa 6-97) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410091M23Rik; C76608; developmental pluripotency associated 4; developmental pluripotency-associated protein 4; Dppa4; ECAT15-1; Embryonic stem cell-associated transcript 15-1 protein; LOC685378; similar to developmental pluripotency associated 4 isoform 1
• Common Name: DPPA4
• Gene Symbol: DPPA4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining