Invitrogen™ Human DTD1 (aa 12-81) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99405	100 μL

Catalog No. RP99405 Supplier Invitrogen™ Supplier No. RP99405

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59376. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ferritin is a ubiquitous and highly conserved protein which plays a major role in iron homeostasis. It is a holoenzyme shell (approximately 450 kDa) consisting of 24 subunits of two types, H (heavy) and L (light), and capable of storing up to 4,500 atoms of ferric iron. Depending on the tissue type and physiologic status of the cell, the ratio of H to L subunits in ferritin can vary widely. It can be viewed not only as part of a group of iron regulatory proteins that include transferrin and the transferrin receptor, but also as a member of the protein family that orchestrates the cellular defense against stress and inflammation. Ferritin is found in the liver, spleen, kidney and heart. Only a small amount is found in the blood. The blood level of ferritin serves as an indicator of the amount of iron stored in the body.

Specifications

• Accession Number: Q8TEA8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 92675
• Name: Human DTD1 (aa 12-81) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610006H08Rik; bA379J5.3; bA555E18.1; C20orf88; D-aminoacyl-tRNA deacylase 1; DNA-unwinding element-binding protein B; DTD; DTD1; D-tyrosyl-tRNA deacylase 1; D-tyrosyl-tRNA deacylase 1 homolog; D-tyrosyl-tRNA(Tyr) deacylase 1; DUEB; DUE-B; Gly-tRNA(Ala) deacylase; HARS2; histidyl tRNA synthetase 2; histidyl-tRNA synthase-related; histidyl-tRNA synthetase 2; MGC119131; MGC41905; pqn-68
• Common Name: DTD1
• Gene Symbol: DTD1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining