Invitrogen™ Human DUSP16 (aa 332-470) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91557	100 μL

Catalog No. RP91557 Supplier Invitrogen™ Supplier No. RP91557

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82721. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dual-specificity phosphatases constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. DUSP16 belongs to a class of DUSPs, designated MKPs, that dephosphorylate MAPK proteins ERK, JNK, and p38 with specificity distinct from that of individual MKP proteins. MKPs contain a highly conserved C-terminal catalytic domain and an N-terminal Cdc25-like domain. MAPK activation cascades mediate various physiologic processes, including cellular proliferation, apoptosis, differentiation, and stress responses.

Specifications

• Accession Number: Q9BY84
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80824
• Name: Human DUSP16 (aa 332-470) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3830417M17Rik; AW558566; D6Ertd213e; dual specificity phosphatase 16; dual specificity protein phosphatase 16; Dusp16; KIAA1700; MAP kinase phosphatase 7; MAP kinase phosphatase-7; map kinase phosphatase-M; MAPK phosphatase-7; MGC129701; MGC129702; mitogen-activated protein kinase phosphatase 7; Mkp7; MKP-7; Mkpm
• Common Name: DUSP16
• Gene Symbol: DUSP16
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSETPLSPPCADSATSEAAGQRPVHPASVPSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGFSSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining