Invitrogen™ Human DUSP19 (aa 6-87) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91570	100 μL

Catalog No. RP91570 Supplier Invitrogen™ Supplier No. RP91570

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54428. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dual-specificity phosphatases.

Specifications

• Accession Number: Q8WTR2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 142679
• Name: Human DUSP19 (aa 6-87) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5930436K22Rik; C79103; dual specificity phosphatase 19; dual specificity phosphatase TS-DSP1; Dual specificity protein phosphatase 19; DUSP17; DUSP19; LMWDSP3; LMW-DSP3; low molecular weight dual specificity phosphatase 3; Protein phosphatase SKRP1; SAPK pathway-regulating phosphatase 1; SKRP1; Stress-activated protein kinase pathway-regulating phosphatase 1; TS-DSP1
• Common Name: DUSP19
• Gene Symbol: DUSP19
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining