Invitrogen™ Human DYRK3 (aa 30-101) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108031	100 μL

Catalog No. RP108031 Supplier Invitrogen™ Supplier No. RP108031

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111727. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DYRK3 belongs to the DYRK family of dual-specificity protein kinases that catalyze phosphorylation of serine/threonine and tyrosine residues. The members of this family share structural similarity, but differ in their substrate specificity, suggesting their involvement in different cellular functions. DYRK3 is a negative regulator of EPO-dependent erythropoiesis, may place an upper limit on red cell production during stress erythropoiesis. Inhibits cell death due to cytokine withdrawal in hematopoietic progenitor cells. May act by regulating CREB/CRE signaling.

Specifications

• Accession Number: O43781
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8444
• Name: Human DYRK3 (aa 30-101) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BC006704; dual specificity tyrosine phosphorylation regulated kinase 3; dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3; dual specificity tyrosine-phosphorylation-regulated kinase 3; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 5; dyrk3; dyrk3 {ECO:0000312; DYRK5; EMBL:AAH97474.1}; hYAK3-2; KSR; protein kinase Dyrk3; RED; REDK; regulatory erythroid kinase; RP11-343H5.2; RSU2
• Common Name: DYRK3
• Gene Symbol: DYRK3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining