Invitrogen™ Human E6AP (aa 31-112) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98049	100 μL

Catalog No. RP98049 Supplier Invitrogen™ Supplier No. RP98049

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UBE3A (ubiquitin-protein ligase E3A, AKA E6AP) is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the ARNTL/BMAL1, ARC, RAD23A, RAD23B, MCM7, annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Additionally, UBE3A may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. UBE3A also plays an important role in the regulation of the circadian clock. Defects in UBE3A are a cause of Angelman syndrome (AS).

Specifications

• Accession Number: Q05086
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7337
• Name: Human E6AP (aa 31-112) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4732496B02; 5830462N02Rik; A130086L21Rik; ANCR; AS; CTCL tumor antigen se37-2; E6AP; E6-AP; E6-AP ubiquitin protein ligase; E6AP ubiquitin-protein ligase; EPVE6AP; FLJ26981; HECT-type ubiquitin transferase E3A; HPVE6A; human papilloma virus E6-associated protein; human papillomavirus E6-associated protein; mKIAA4216; oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A; ubiquitin conjugating enzyme E3A; ubiquitin protein ligase E3A; ubiquitin-protein ligase E3A
• Common Name: E6AP
• Gene Symbol: UBE3A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining