Invitrogen™ Human EBAG9 (aa 122-212) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91872	100 μL

Catalog No. RP91872 Supplier Invitrogen™ Supplier No. RP91872

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110868. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene.

Specifications

• Accession Number: O00559
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9166
• Name: Human EBAG9 (aa 122-212) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI835379; BAG9; cancer associated surface antigen; cancer associated surface antigen RCAS1; cancer-associated surface antigen RCAS1; EB9; EBAG9; estrogen receptor binding fragment associated gene 9; estrogen receptor binding site associated, antigen, 9; estrogen receptor-binding fragment-associated gene 9; estrogen receptor-binding fragment-associated gene 9 protein; HGNC:3123; PDAF; Rcas1; receptor binding cancer antigen expressed on SiSo cells; Receptor-binding cancer antigen expressed on SiSo cells
• Common Name: EBAG9
• Gene Symbol: EBAG9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining