Invitrogen™ Human EBP1 (aa 93-228) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91309	100 μL

Catalog No. RP91309 Supplier Invitrogen™ Supplier No. RP91309

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.

Specifications

• Accession Number: Q9UQ80
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5036
• Name: Human EBP1 (aa 93-228) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 38kDa; AA672939; Cell cycle protein p38-2G4 homolog; Ebp1; ErbB-3 binding protein 1; ErbB3-binding protein 1; ErbB3-binding protein Ebp1; hG4 1; hG4-1; IRES-specific cellular trans-acting factor 45 kDa; ITAF45; MGC81621; MGC94070; Mpp1; p38 2G4; p38-2G4; Pa2g4; Plfap; proliferation-associated 2G4; proliferation-associated 2G4, 38kD; proliferation-associated 2G4, 38kDa; proliferation-associated protein 1; Proliferation-associated protein 2G4; protein p38-2G4; si:dz150i12.2; wu:fb19b11; wu:ft56d05; zgc:86732
• Common Name: EBP1
• Gene Symbol: Pa2g4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining