Invitrogen™ Human EEF2K (aa 597-678) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106680	100 μL

Catalog No. RP106680 Supplier Invitrogen™ Supplier No. RP106680

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84276. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EEF2K is a highly conserved Serine/Threoning kinase in the calmodulin signaling pathway whose activity is increased in cancers including breast cancer. EEF2K (eukaryotic elongation factor 2 kinase) is a threonine kinase that regulates protein synthesis by controlling the rate of peptide chain elongation. Up activation, by a variety of upstream kinases including AMPK or TRPM7, EEF2K phosphorylates the elongation factor EEF2 at a single site. Then, EEF2K renders EEF2 unable to bind ribosomes and inactive - in turn, the rate of protein synthesis is reduced.

Specifications

• Accession Number: O00418
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 29904
• Name: Human EEF2K (aa 597-678) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C86191; Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase; calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase; calmodulin-dependent protein kinase III; EC 2.7.11.20; eEF-2 kinase; Eef2k; eEF-2K; EF2K; elongation factor 2 kinase; elongation factor-2 kinase; euk; eukaroytic elongation factor 2 kinase; eukaryotic elongation factor 2 kinase; eukaryotic elongation factor-2 kinase; HSU93850; kinase eEF2K; SMEF2K
• Common Name: EEF2K
• Gene Symbol: EEF2K
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining