Invitrogen™ Human EHD3 (aa 27-77) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100845	100 μL

Catalog No. RP100845 Supplier Invitrogen™ Supplier No. RP100845

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62079. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The EHD3 gene encodes the EH-domain containing protein 3, part of the EHD protein family involved in the regulation of endocytic recycling and membrane trafficking. EHD3 plays a crucial role in the endosomal transport system, impacting how receptors and other membrane proteins are recycled back to the cell surface after internalization. This protein aids in maintaining cellular homeostasis by ensuring the efficient sorting and transport of cargo through the endosomal system. EHD3 has been implicated in various cellular functions, including insulin signaling, receptor recycling, and neuronal development, and significantly influences synaptic transmission and plasticity. Alterations in EHD3 expression or function can disrupt endosomal trafficking processes and are linked to conditions such as neurodegenerative diseases and cancer. Research on EHD3 is focused on uncovering its role in membrane dynamics and identifying potential therapeutic strategies for disorders involving dysfunctional endocytic pathways.

Specifications

• Accession Number: Q9NZN3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 30845
• Name: Human EHD3 (aa 27-77) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: EH domain containing 3; EH domain-containing protein 3; Ehd2; Ehd3; EH-domain containing 3; EH-domain containing protein 2; PAST homolog 3; PAST3; si:ch211-147c1.2
• Common Name: EHD3
• Gene Symbol: EHD3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining