Invitrogen™ Human eIF6 (aa 101-180) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99421	100 μL

Catalog No. RP99421 Supplier Invitrogen™ Supplier No. RP99421

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene.

Specifications

• Accession Number: P56537
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3692
• Name: Human eIF6 (aa 101-180) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110004P11; AA408895; b(2)gcn; B(2)GCN homolog; B4 integrin interactor; CAB; EIF3A; Eif6; eIF-6; eIF-6 {ECO:0000255; eukaryotic translation initiation factor 3A; eukaryotic translation initiation factor 6; eukaryotic translation initiation factor 6 {ECO:0000255; HAMAP-Rule:MF_03132}; imc-415; integrin beta 4 binding protein; Itgb4bp; OK/SW-cl.27; p27 beta-4 integrin-binding protein; p27(BBP); p27BBP
• Common Name: eIF6
• Gene Symbol: Eif6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining