Invitrogen™ Human ENPP2 (aa 326-413) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106483	100 μL

Catalog No. RP106483 Supplier Invitrogen™ Supplier No. RP106483

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65809. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

• Accession Number: Q13822
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5168
• Name: Human ENPP2 (aa 326-413) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ATX; ATX-X; autotaxin; AutotaxinATX; autotaxin-t; ectonucleotide pyrophosphatase/phosphodiesterase 2; ectonucleotide pyrophosphatase/phosphodiesterase family member 2; E-NPP 2; Enpp2; Extracellular lysophospholipase D; FLJ26803; lysoPLD; NPP2; Npps2; PD-IALPHA; PDNP2; phosphodiesterase I/nucleotide pyrophosphatase 2; phosphodiesterase I/nucleotide pyrophosphatase 2 (autotaxin); plasma lysophospholipase D
• Common Name: ENPP2
• Gene Symbol: ENPP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining