Invitrogen™ Human EphA8 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94014	100 μL

Catalog No. RP94014 Supplier Invitrogen™ Supplier No. RP94014

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EPHA8 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. EPHA8 plays a role in short-range contact-mediated axonal guidance during development of the mammalian nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.

Specifications

• Accession Number: P29322
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2046
• Name: Human EphA8 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW047546; Eek; EK3; epa8; EPH- and ELK-related kinase; EPH- and ELK-related tyrosine kinase; Eph receptor A8; Epha8; EPH-like kinase 3; Ephrin type-A receptor 8; Ephrin type-A receptor 8 precursor (Tyrosine-protein kinase receptor EEK) (EPH-and ELK-related kinase); Hek3; hydroxyaryl-protein kinase; KIAA1459; mKIAA1459; protein-tyrosine kinase; tyrosine-protein kinase receptor EEK; tyrosylprotein kinase
• Common Name: EphA8
• Gene Symbol: Epha8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining