Invitrogen™ Human EPS15 (aa 798-874) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108455	100 μL

Catalog No. RP108455 Supplier Invitrogen™ Supplier No. RP108455

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EPS15 is a ubiquitously expressed protein that is involved in cell growth regulation and may be involved in the regulation of mitogenic signals and control of cell proliferation. Phosphorylation of EPS15 on Tyrosine 849 upon DNA damage is involved in the internalization of EGFR. A chromosomal aberration involving EPS15 is also found in acute leukemias, resulting in a rogue activator protein.

Specifications

• Accession Number: P42566
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2060
• Name: Human EPS15 (aa 798-874) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410112D09Rik; AF1P; AF-1P; AF-1p protein; ALL1 fused gene from chromosome 1; epidermal growth factor pathway substrate 15; epidermal growth factor receptor pathway substrate 15; epidermal growth factor receptor substrate 15; EPS15; MLLT5; protein AF-1p; Protein Eps15; RGD1307641
• Common Name: EPS15
• Gene Symbol: EPS15
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining