Invitrogen™ Human EPS8L1 (aa 11-90) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99081	100 μL

Catalog No. RP99081 Supplier Invitrogen™ Supplier No. RP99081

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eps8L1 (EPS8-like 1), also known as DRC3 or EPS8R1, is a 723 amino acid protein that localizes to the cytoplasm and belongs to the Eps8 (epidermal growth factor receptor pathway substrate 8) family. Expressed in placental tissue, Eps8L1 functions to stimulate the guanine exchange activity of Sos 1 (son of sevenless homolog 1), a protein that promotes the exchange of Ras-bound GDP for GTP. Additionally, Eps8L1 is thought to associate with Actin and, via this association, may play a role in membrane ruffling and remodeling of the Actin cytoskeleton. Through its ability to regulate protein activation and cytoskeleton dynamics, Eps8L1 may participate in cell growth and differentiation events within the cell. Eps8L1 contains one SH3 domain and is expressed as four isoforms due to alternative splicing events.

Specifications

• Accession Number: Q8TE68
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54869
• Name: Human EPS8L1 (aa 11-90) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310051G19Rik; 4632407K17Rik; AW060268; DRC3; Epidermal growth factor receptor kinase substrate 8-like protein 1; epidermal growth factor receptor pathway substrate 8-related protein 1; EPS8 like 1; Eps8l1; EPS8-like 1; EPS8-like protein 1; Eps8r1; EPS8-related protein 1; PP10566
• Common Name: EPS8L1
• Gene Symbol: EPS8L1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPDHVTLLDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining