Invitrogen™ Human ERAL1 (aa 331-437) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93313	100 μL

Catalog No. RP93313 Supplier Invitrogen™ Supplier No. RP93313

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a GTPase that localizes to the mitochondrion. The encoded protein binds to the 3' terminal stem loop of 12S mitochondrial rRNA and is required for proper assembly of the 28S small mitochondrial ribosomal subunit. Deletion of this gene has been shown to cause mitochondrial dysfunction, growth retardation, and apoptosis. Several transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O75616
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26284
• Name: Human ERAL1 (aa 331-437) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610524P08Rik; 9130407C09Rik; AU019798; CEGA; Conserved ERA-like GTPase; ERA; era (E. coli G-protein homolog)-like 1; Era (G-protein)-like 1; Era (G-protein)-like 1 (E. coli); Era G-protein-like 1; Era like 12S mitochondrial rRNA chaperone 1; Eral1; ERAL1A; Era-like 1; Era-like 12S mitochondrial rRNA chaperone 1; ERA-like GTPase; ERA-like protein 1; ERA-W; GTPase Era, mitochondrial; GTPase, human homolog of E. coli essential cell cycle protein Era; GTP-binding protein era homolog; HERA; H-ERA; HERA-A; HERA-B; Mera; M-ERA; MERA-S; MERA-W
• Common Name: ERAL1
• Gene Symbol: ERAL1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining