Invitrogen™ Human ERGIC3 (aa 156-228) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90949	100 μL

Catalog No. RP90949 Supplier Invitrogen™ Supplier No. RP90949

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53289. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ERGIC3 is possible role in transport between endoplasmic reticulum and Golgi.

Specifications

• Accession Number: Q9Y282
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51614
• Name: Human ERGIC3 (aa 156-228) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310015B14Rik; AV318804; C20orf47; CGI-54; D2Ucla1; dJ477O4.2; Endoplasmic reticulum-Golgi intermediate compartment protein 3; endoplasmic reticulum-localized protein ERp43; ERGIC and golgi 3; ERGIC3; ERV46; NY-BR-84; PRO0989; Sdbcag84; serologically defined breast cancer antigen 84; serologically defined breast cancer antigen NY-BR-84; Serologically defined breast cancer antigen NY-BR-84 homolog
• Common Name: ERGIC3
• Gene Symbol: ERGIC3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining