Invitrogen™ Human ERK1 (aa 27-157) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102150	100 μL

Catalog No. RP102150 Supplier Invitrogen™ Supplier No. RP102150

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAPK3 (ERK1) is a serine/threonine kinase that is an important activator of p90, RSK, MSK, ELK1, and Stat3, and is involved in the MAPK pathway. ERK1 is widely expressed and involved in the regulation of meiosis, mitosis, and post-mitotic functions in differentiated cells. Many different stimuli, including growth factors, cytokines, virus infection, ligands for heterotrimeric guanine nucleotide-binding protein (G protein)-coupled receptors and transforming agents, activate the ERK1 and ERK2 pathways. Functionally, ERK1 is involved with a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. ERK1 is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms of ERK1 have been described.

Specifications

• Accession Number: P27361
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5595
• Name: Human ERK1 (aa 27-157) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ERK; Erk1; ERK-1; Ert2; Esrk1; Extracellular signal-regulated kinase 1; extracellular signal-related kinase 1; HS44KDAP; HUMKER1A; Insulin-stimulated MAP2 kinase; MAP kinase 1; MAP kinase 3; MAP kinase isoform p44; MAP kinase2; MAPK 1; MAPK 3; MAPK1; MAPK2; MAPK3; Microtubule-associated protein 2 kinase; mitogen activated protein kinase 3; mitogen-activated 3; mitogen-activated protein kinase 1; mitogen-activated protein kinase 3; MNK1; Mtap2k; p44; p44 MAP kinase; P44ERK1; p44-ERK1; P44MAPK; p44-MAPK; pp42/MAP kinase; PRKM3
• Common Name: ERK1
• Gene Symbol: MAPK3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining