Invitrogen™ Human ERK5 (aa 354-437) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105848	100 μL

Catalog No. RP105848 Supplier Invitrogen™ Supplier No. RP105848

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAPK7 (ERK5) serine/threonine kinase is a member of the MAP kinase family and is involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. MAPK7 is activated by mitogen-activated protein kinase 5 (MAP2K5/MEK5) and is involved in downstream signaling processes of various receptors. In response to extracelluar signals, MAPK7 translocates to the cell nucleus where it regulates gene expression by phosphorylating and activating different transcription factors. Gene deletion of MAPK7 in mice results in defective blood vessel and cardiac development leading to embryonic lethality. MAPK7 has been shown to be critical for endothelial function and maintenance of blood vessel integrity. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported. ERK5 is expressed in many adult tissues, abundantly in heart, placenta, lung, kidney and skeletal muscle, but is not detectable in liver.

Specifications

• Accession Number: Q13164
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5598
• Name: Human ERK5 (aa 354-437) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Big MAP kinase 1; BMK1; BMK-1; BMK1 kinase; BNhp-1; BNhp1 kinase; ERK4; ERK5; ERK-5; Erk5-T; extracellular signal regulated kinase 5; extracellular signal-regulated kinase 5; extracellular-signal-regulated kinase 5; MAP kinase 7; MAPK 7; Mapk7; mitogen activated protein kinase 7; mitogen-activated protein kinase 7; PRKM7
• Common Name: ERK5
• Gene Symbol: MAPK7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining