Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human ETK (aa 129-247) Control Fragment Recombinant Protein

Catalog No. RP91993
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91993 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91993 Supplier Invitrogen™ Supplier No. RP91993
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81915. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Bone marrow tyrosine kinase (BMX) is a non-receptor tyrosine kinase that belongs to the SRC-related TEC subfamily of tyrosine kinases. It is an important regulator of various cellular processes including apoptosis, cell survival, cellular differentiation, cell migration, and transformation. One family of nonreceptor TKs includes the genes TEC (MIM 600583), TXK (MIM 600058), ITK (MIM 186973), and BTK (MIM 300300). All of these proteins are homologs of the Drosophila Src28 TK and contain an SH3 and SH2 domain upstream of the TK domain.[supplied by OMIM].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P51813
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 660
Name Human ETK (aa 129-247) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias BMX; BMX non-receptor tyrosine kinase; bone marrow tyrosine kinase gene in chromosome X protein; Bone marrow tyrosine kinase gene in chromosome X protein homolog; BTK-like on X chromosome; cytoplasmic tyrosine-protein kinase BMX; epa3; Epithelial and endothelial tyrosine kinase; ETK; Etk/Bmx; Etk/Bmx cytosolic tyrosine kinase; NTK38; NTK38 tyrosine kinase; PSCTK2; PSCTK3; RGD1565643; Tyro8; TYRO8 protein tyrosine kinase 8
Common Name ETK
Gene Symbol BMX
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.