Invitrogen™ Human EVX1 (aa 2-76) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106604	100 μL

Catalog No. RP106604 Supplier Invitrogen™ Supplier No. RP106604

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65925. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis.

Specifications

• Accession Number: P49640
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2128
• Name: Human EVX1 (aa 2-76) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: eve, even-skipped homeo box homolog 1; eve, even-skipped homeobox homolog 1; even skipped homeotic gene 1 homolog; even-skipped homeo box 1 (homolog of Drosophila); even-skipped homeobox 1; Evx1; EVX-1; Homeobox even-skipped homolog protein 1; NEWGENE_1565788
• Common Name: EVX1
• Gene Symbol: EVX1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining