Invitrogen™ Human Evx2 (aa 57-106) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99916	100 μL

Catalog No. RP99916 Supplier Invitrogen™ Supplier No. RP99916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59632. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EVX2, a protein related to the Drosophila even-skipped (eve), is expressed in limbs like the neighbouring Hoxd genes. Evx-2 functions like a Hoxd gene.

Specifications

• Accession Number: Q03828
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 344191
• Name: Human Evx2 (aa 57-106) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: eve, even-skipped homeo box homolog 2; even skipped homeotic gene 2; even skipped homeotic gene 2 homolog; even-skipped homeo box 2 (homolog of Drosophila eve); even-skipped homeobox 2; Evx2; Evx-2; Homeobox even-skipped homolog protein 2; LOW QUALITY PROTEIN: homeobox even-skipped homolog protein 2
• Common Name: Evx2
• Gene Symbol: EVX2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining