Invitrogen™ Human EXOC6 (aa 145-195) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106916	100 μL

Catalog No. RP106916 Supplier Invitrogen™ Supplier No. RP106916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66234. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

• Accession Number: Q8TAG9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54536
• Name: Human EXOC6 (aa 145-195) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4833405E05Rik; AW413330; C430002C19; DKFZp761I2124; Exoc6; EXOC6A; Exocyst complex component 6; exocyst complex component Sec15A; FLJ1125; FLJ11251; hbd; MGC33397; msec15; rSec15; rsec15-like protein; Sec15; SEC15 homolog; SEC15A; SEC15L; SEC15L1; SEC15L3; SEC15-like 1; SEC15-like protein 1; SEC15-like protein 3; Sec15p; zgc:77548
• Common Name: EXOC6
• Gene Symbol: Exoc6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining